Pay in 4 interest-free payments of $323.57 Learn more
Ships within 48 hours · Estimated delivery Aug 29 - Sep 3
Protein Names:Recommended name: Alternative oxidase 1
Gene Names: BANK1
MW: 28 kDa
AA Sequence:CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVL NLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTL QQVLRSMVSNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGW FTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV
Protein Names:Recommended name: Ankyrin repeat domain-containing protein 46 Alternative name(s): Ankyrin repeat small protein Short name= ANK-S
Recombinant Arabidopsis thaliana Probable 3-ketoacyl-CoA synthase 2(KCS2) DNA Ligases Protein Names:Recommended name: Alternative oxidaseSize: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse ear cress) Uniprot NO.: O65677 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris based buffer,50% glycerol, optimized for this protein Storage: Store at 20, for extended storage, conserve at 20 or 80. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at
